Google
More documentation can be found on the ARB website.
Last update on 25. Oct 2009 .
Main topics:
Related topics:

protml.doc

DISCLAIMER

This file has been automatically converted from the original documentation for easy use inside the ARB help system. Differences compared with the original documentation are unintentionally caused by the conversion process. In doubt please refer to the original documentation!

 

DOCUMENTATION

PROTML Maximum Likelihood Inference of Protein Phylogeny

  • Jun Adachi 1) and Masami Hasegawa 2)
  • 1) Department of Statistical Science, The Graduate University for Advanced Study 4-6-7 Minami-Azabu, Minato-ku, Tokyo 106, Japan
  • 2) The Institute of Statistical Mathematics 4-6-7 Minami-Azabu, Minato-ku, Tokyo 106, Japan

INTRODUCTION

  • PROTML is a PASCAL program for inferring evolutionary trees from protein (amino acid) sequences by using maximum likelihood.
  • A maximum likelihood method for inferring trees from DNA or RNA sequences was developed by Felsenstein (1981). The method does not impose any constraint on the constancy of evolutionary rate among lineages. He wrote a program (DNAML) implementing the method, and included it in his program package, PHYLIP. The program has been used extensively and has proved of great use in phylogenetic studies (Hasegawa and Yano, 1984a; Hasegawa et al., 1985, 1990a; Hasegawa and Kishino, 1989; Kishino and Hasegawa, 1989; Zillig et al., 1989; Hasegawa, 1990, 1991; Golenberg et al., 1990; Adkins and Honeycutt, 1991; Doebley et al., 1991; Edwards et al., 1991; Les et al., 1991; Ruvolo et al., 1991; Disotell et al., 1992; Lockhart et al., 1992). Computer simulations have demonstrated that the method is highly efficient in estimating a true tree under various situations such as a violation of rate constancy among lineages (Hasegawa and Yano, 1984b; Hasegawa et al., 1991).
  • DNAML, however, is confined to DNA or RNA sequence data, and is not applicable to protein sequence data. In phylogenetic studies of deep branchings, such as those among the three major kingdoms of eukaryotes, archaebacteria and eubacteria, and those in the early evolution of eukaryotes, ribosomal RNA sequence data has been used widely (e.g., Woese, 1989; Sogin et al., 1989). In spite of many works on the ribosomal RNAs, the universal root of all contemporary organisms on the earth including eukaryotes, archaebacteria and eubacteria remained uncertain. Miyata and his coworkers demonstrated the usefulness of using amino acid sequence data encoded by duplicated genes (duplicated prior to the divergence among the major kingdoms) in establishing the universal root (Iwabe et al., 1989; Hasegawa et al., 1990b; Miyata et al., 1991). Furthermore, an evolutionary tree inferred from ribosomal RNA data is sometimes misleading when base composition differs widely among lineages, and a tree inferred from protein sequences is more reliable in such cases (Loomis and Smith, 1990; Hasegawa et al., 1993).
  • Because no program was available for inferring a protein tree by maximum likelihood based on a reasonable model of amino acid substitutions, many authors used DNAML in analyzing protein-encoding DNA sequences. As is well known, the third position of codons evolve more rapidly than other positions, and therefore DNAML was designed so that a user could specify the relative rates of substitutions in several categories of positions. This approach seems to be good in many cases when one is interested in phylogenetic relationships among closely related species.
  • Even if the rate difference among positions in a codon are taken into account, however, inclusion of the third positions in the analysis can sometimes be misleading when the pattern of codon usage differs among lineages. Furthermore, the assumption (in DNAML) of independent evolution among three positions of a codon can be a serious defect when one is interested in tracing deep branchings, because a (negative) selection is likely to be operating at the codon level, rather than at the individual sites in the codon. Even if nucleotide frequencies of protein-encoding genes differ among lineages, amino acid frequencies may not differ significantly (Adachi and Hasegawa, 1992). Therefore, if the amino acid substitution process can be represented by an appropriate model, it seems to be better to handle amino acid sequences rather than nucleotide sequences in estimating orders of deep branchings from data of a protein-encoding gene, and there is an increasing demand for a maximum likelihood program to infer protein phylogenies.
  • Kishino et al. (1990) developed a maximum likelihood method for inferring protein phylogenies that takes account of unequal transition probabilities among pairs of amino acids by using an empirical transition matrix compiled by Dayhoff et al. (1978), and the model is called the Dayhoff model (Hasegawa et al., 1992). Although the transition matrix was constructed from a limited data set (accumulated up to 1978) of proteins encoded in nuclear DNA, the Dayhoff model is not necessarily specific only to those proteins, but is appropriate in approximating the amino acid substitutions of wider protein species including mitochondrial ones (Hasegawa et al., 1993; Adachi and Hasegawa, 1992; Adachi et al., 1992).
  • The original program for private use in Kishino et al. (1990), Mukohata et al. (1990), Hasegawa et al. (1990b), Iwabe et al. (1991), and Miyata et al. (1991) was written in FORTRAN and the number of species in the maximum likelihood analysis was confined to five. In writing this program "PROTML" for public use, we took advantage of another computer language, PASCAL, to represent the tree structure of the data. In this program, there is no limit on the number of species, provided the computer is big enough.
  • Since the number of possible tree topologies increases explosively as the number of species increases (Felsenstein, 1978a), it is a serious problem to find the best tree among the huge number of alternatives. We have developed a novel algorithm for searching tree topologies, called "star decomposition", which seems to be effective in finding the best tree.
  • The parsimony method has been used widely in molecular phylogenetics, but it may be positively misleading when the evolutionary rate differs among lineages (Felsenstein, 1978b). PROTML has proved of great use in inferring evolutionary trees even in such situations (Hasegawa et al., 1992), and has been applied to several phylogenetic problems (Hasegawa et al., 1993; Adachi and Hasegawa, 1992; Adachi et al., 1992; Hashimoto et al., 1993).
  • The overall structure of PROTML is similar to that of Felsenstein's DNAML. We owe very much to DNAML in the writing PROTML, and have adopted several fundamental routines from the DNAML program. Furthermore, the input format of PROTML is quite similar to that of DNAML. Features where PROTML differs from DNAML (up to version 3.4) are as follows:
    • (1) Amino acid sequence data are analyzed based on Dayhoff's model(1978).
    • (2) The likelihood of multifurcating trees can be estimated.
    • (3) A novel method of topology search ("star decomposition") is adopted.
    • (4) The Newton method is adopted in the maximization of likelihood.
    • (5) Bootstrap probabilities of candidate trees can be estimated.


ALGORITHM FOR TOPOLOGY SEARCH

  • Topological Data Structure
    • Felsenstein considered a data structure representing the unrooted tree, where each internal node (excluding external nodes or tips) is decomposed into elements, the number of which coincides with those of branches stemming from the node. The elements are connected circularly through the pointers.
    • By adopting such a data structure, we can store a partial likelihood of a sub-tree stemming from the node. This means that, when we estimate the likelihood of the tree, we need not calculate likelihood through iteration of a loop by the times of the number of nodes in revising the estimate of each branch length, but need only revise the partial likelihoods of two nodes of each branch.
    • We extend this data structure so that a multifurcating tree can be represented. Since branches are connected dynamically by pointers, the data structure can easily be revised when a different tree topology is adopted, and furthermore not only bifurcating trees but also multifurcating trees can be represented quite easily. The extreme limit of a multifurcating tree is the star-like tree.

  • Automatic Topology Search by Star Decomposition
    • The straightforward approach to inferring a tree would be to evaluate all possible tree topologies one after another and pick the one which gives the highest likelihood. This would not be possible for more than a small number of species, since the number of possible tree topologies is enormous (Felsenstein, 1978a).
    • The strategy that Felsenstein's DNAML employs is as follows: the species are taken in the order in which they appear in the input file. The first three are taken and an unrooted tree is constructed containing only those three. Then, the fourth species is taken, and it is evaluated to see where it might best be added to the tree. All possibilities (bifurcating trees) for adding the fourth species are examined. The best one under the likelihood criterion is chosen to be the basis for further operations. Then the fifth species is added, and again the best placement of it is chosen, and so on. At each step, local rearrangements of a tree are examined. This procedure is continued until a bifurcating tree connecting all the species is obtained (Felsenstein, 1992).
    • The resulting tree from this procedure generally depends on the order of the input species. Hence, Felsenstein recommends performing a number of runs with different orderings of the input species.
    • The alternative strategy which we employ in the automatic and semi-automatic search options of PROTML is called "star decomposition". This is similar to the procedure employed in the neighbor-joining method using a distance matrix (Saitou and Nei, 1987). This method starts with a star-like tree. Decomposing the star-like tree step by step, we finally obtain a bifurcating tree if all multifurcations can be resolved with statistical confidence. Since the information from all of the species under analysis is used from the beginning, the inference of the tree topology is likely to be stable by this procedure.
    • Let be the number of species under analysis. At first, a star-like tree containing species is constructed. Then, a pair of species is separated from others. Among all possible pairwise combinations of species, a pairing that gives the highest likelihood is chosen. The resulting tree can be regarded as a star-like tree with groups (a single species may form a group), if the selected pair is regarded to form a group. This procedure is continued until all multifurcating nodes are resolved into bifurcating ones.
    • When the information content of the data is not large enough to discriminate among alternative branching orders, it might be misleading to resolve all the multifurcations into bifurcations. Hence, by using "Akaike Information Criteria (AIC)" (Akaike, 1974), the program decides whether the multifurcation should further be resolved or not.


PROTML USER'S GUIDE

  • Options
    • The program allows various options that alter the amount of information the program is provided or what it is to be done with the information. The program is notified that an option has been invoked by the presence of one or more letters after the last number on the first line of the input file. These letters may or may not be separated from each other by blanks, though it is usually necessary to separate them from the number by a blank. They can be in any order. Thus to invoke options U, W and B, the input file starts with the line:

                                          19 409  UWB
                                        

    • or

                                          19 409  W U B
                                        

    • This program has three mode of topology search; i.e., Automatic mode, Semi-automatic mode and User tree (manual) mode.
    • Automatic mode.

      Unless specified otherwise, the procedure uses automatic mode, so it starts with a star-like tree.

    • "S" : Semi-automatic mode.

      Semi-automatic mode starts with a multifurcating tree that a user designates.

    • "U" : User tree mode.

      User tree (manual) mode is similar to the "U" option in Felsenstein's DNAML. This mode calculates the likelihood of all user defined topologies. Different from DNAML, this program allows multifurcating trees as user trees.

    • "W" : Write option.

      Using this option, the program will produce more information than it dose for standard output.

    • "B" : Bootstrap option.

      This option gives the approximate bootstrap probabilities of candidate trees by a resampling of estimated likelihood (RELL) method (Kishino et al., 1990).


  • Format of input data file
    • We have tried to adhere to a rather stereotyped input format similar to that of Felsenstein's programs. The simplest version of the input file looks something like this:

                                              4   40   W
      species1 ARNDCQEGHILKAFPMTWYVARNDCQEGHISKMFGWTWYV
      species2 ARNHNQCGHILKMFPMTSYVARNCCAEHHILKHFPSTWIV
      species3 AINDCQEGHHLKMFPMTMYSVRNRIQEMHIQKHCPHTHYV
      species4 AINHCQCEHILWMFPSTPYVARNDIQNYHILKMPPSTWWV
                                        

    • The first line of the input file contains the number of species and the length of amino acid sequences, in free format, separated by blanks. The information for each species follows, starting with a ten-character species name (which can include punctuation marks), and continuing with the characters for that species.
    • An input file has three parts of data; i.e., arguments, sequences and topologies.
      1. Arguments

        The first line of the file gives number of species, sequence length, and options.

      2. Sequences

        The following lines give species names and amino acid sequence data. The amino acids must be specified by the one letter codes adopted by IUPAC-IUB Commission on Biochemical Nomenclature (1968). The amino acid code must be one of the twenty.

      3. Topologies

        If one specifies User or Semi-automatic options, one mast specify the number of topologies followed by the topologies themselves.


    • This program allows the option U, which signals that user-defined tree(s) are provided. The topologies of these trees are supplied AFTER the species and sequence data, rather than before them. The letter U appears on the first line of the file. After the species and sequence data, a line containing the number of user-defined trees appears. Each user-defined tree starts on a new line. Here is an example with three user-defined trees:
      •                                           5   40   U   B
        species1 ARNDCQEGHILKAFPMTWYVARNDCQEGHISKMFGWTWYV
        species2 ARNHNQCGHILKMFPMTSYVARNCCAEHHILKHFPSTWIV
        species3 AINDCQEGHHLKMFPMTMYSVRNRIQEMHIQKHCPHTHYV
        species4 AINHCQCEHILWMFPSTPYVARNDIQNYHILKMPPSTWWV
        species5 AINDCSCGHHLWMFPSLCYVRRNECQGGHIWKMFPLTVCA
            3
        (((species1,species2),species3),species4,species5)
        ((species1,species2),(species3,species4),species5)
        (species1,(species2,species3),(species4,species5))
                                            

        An example of semi-auto mode is as follows:

      •                                           5   40   S
        species1 ARNDCQEGHILKAFPMTWYVARNDCQEGHISKMFGWTWYV
        species2 ARNHNQCGHILKMFPMTSYVARNCCAEHHILKHFPSTWIV
        species3 AINDCQEGHHLKMFPMTMYSVRNRIQEMHIQKHCPHTHYV
        species4 AINHCQCEHILWMFPSTPYVARNDIQNYHILKMPPSTWWV
        species5 AINDCSCGHHLWMFPSLCYVRRNECQGGHIWKMFPLTVCA
                                            
      • ((species1,species2,species3),species4,species5)

    • The tree topology is specified by nested pairs of parentheses, enclosing species names and separated by commas. Trailing blanks in the name may be omitted. The pattern of the parentheses indicates the pattern of the tree by having each pair of parentheses enclose all the members of a monophyletic group. The entire tree is enclosed in an outermost pair of parentheses. Note that the tree is an unrooted one, and therefore its base must be multifurcation with a multiplicity of greater than or equal to three. A specification of a tree ends with a semicolon which may be omitted.

  • Program Constants

    The CONSTants in program that may be changed by a user are:

                                      CONST
    maxsp     : maximum number of species
    maxnode   : maxsp * 2 - 3
    maxpair   : maxsp * (maxsp-1) / 2
    maxsite   : maximum number of sites
    maxptrn   : maximum number of different site patterns
    maxtree   : maximum number of user trees
    maxsmooth : number of smoothing algorithm
    maxiterat : number of iterates of Newton method
    epsilon   : stopping value of error
    minarc    : lower limit on number of substitutions per branch
    maxarc    : upper limit on number of substitutions per branch
    prprtn    : proprtion of branch length
    maxboot   : number of bootstrap replications
    maxexe    : number of jobs
    maxline   : length of sequence output per line
    maxname   : maximum number of characters in species name
    maxami    : number of amino acids
    minreal   : if job is in underflow error, increase this value
    seqfname  : input file of sequence data
    tpmfname  : input file of transition probability
    lklfname  : output file of log-likelihood
                                    

  • Output Format
    • The output usually consists of
      • (1) the name of the program and its version number,
      • (2) the input information printed out, and
      • (3) a series of trees,

    • some with associated information indicating how much change there was in each character or on each part of the tree.
    • The tree grows from left to right and has branches that are approximately proportional in length to the lengths that the program estimates. In some cases when branches are estimated to be very short, the output makes them three spaces long so that the topology is clearly shown. Here is what a typical tree looks like:

                                          .
       :-----------1.Tabac.chl
      0:
       :        :-------2.Prochloro
       :   :----6
       :   :    :---3.Anacystis
       :---7
       :   :------------------5.Synechocy
       :
       :------4.Fremyella
      .
      No.            number   Length       S.E.
                                        
      •                                         ---------------------------------------------
           Tabac.chl     1     9.44861  (  1.63423 )
           Prochloro     2     5.69634  (  1.30862 )
           Anacystis     3     1.57704  (  0.74325 )
           Fremyella     4     4.92061  (  1.24297 )
           Synechocy     5    16.05818  (  2.24639 )
                         6     2.13260  (  0.86082 )
                         7     1.01070  (  0.63908 )
                                              
      •                                         ---------------------------------------------
        ln L : -1813.614 (  66.205 )  AIC : 3641.229
                                              
      • ---------------------------------------------

    • Length refers to the estimated number of substitutions per 100 amino acid sites along the branch leading to the node (or leaf) indicated by the number, and S.E. refers to its standard error estimated by the formula of Kishino and Hasegawa (1989).


Installing PROTML and Executive Environment

  • Personal computer with MS-DOS + Turbo Pascal(Borland): e.g. IBM PCs and compatibles, NEC PC-98x. Please remove or change comments marked as shown below:

                                    (*  <statements>  TURBO Pascal *)
                                  

  • UNIX Workstation + standard Pascal compiler: e.g. SUN. Please remove or change comments marked as shown below:

                                    (*  <statements>  SUN Pascal *)
                                  

  • Mainframe computer (IBM and compatibles) + standard Pascal compiler. For example, JCL (Job Control Language) of batch job.

                                    //USERIDB    JOB  PATHWORD
    //STEP       EXEC OPASCLG
    //PASC.SYSIN DD   DSN='USERID.PROTML.PASCAL',DISP=SHR
    //GO.SEQFILE DD   DSN='USERID.SEQFILE.DATA',DISP=SHR
                                  


How to contact developers

  • The best way to contact developers is to send an E-mail.

    E-mail: adachi@ism.ac.jp

  • If you prefer, write a letter with your comments and send it to

    Jun Adachi Department of Statistical Science, The Graduate University for Advanced Study, 4-6-7 Minami-Azabu, Minato-ku, Tokyo 106, Japan FAX: +81-3-3446-1695

  • Please send a mail with the following information
    1. Computer brand, model.
    2. The brand and version number of Pascal compiler.
    3. Operating system and version number.
    4. The input file of sequence data.
    5. The output file.


Acknowledgements

We are particularly grateful to Dr. H. Kishino for invaluable advices during the course of this work, and to Dr. J. Felsenstein for generously permitting us to use routines in DNAML. We also thank Drs. T. Hashimoto, T. Miyata and T. Yano for discussions and comments. This work was carried out under the Institute of Statistical Mathematics Cooperative Research Program (90-ISM-57, 91-ISM-69), and was supported by grants from the Ministry of Education, Science, and Culture of Japan.

References

  • Adachi, J., Hasegawa, M. (1992); Amino acid substitution of proteins coded for in mitochondrial DNA during mammalian evolution. Jpn. J. Genet., 67:187-197.
  • Adachi, J., Cao, Y., Hasegawa, M. (1993); Tempo and mode of mitochondrial DNA evolution in vertebrates at the amino acid sequence level: rapid evolution in warm-blooded vertebrates. J. Mol. Evol., (in press).
  • Adkins, R.M., Honeycutt, R.L. (1991); Molecular phylogeny of the superorder Archonta. Proc. Natl. Acad. Sci. US., 88:10317-10321.
  • Akaike, H. (1974); A new look at the statistical model identification. IEEE Trans. Autom. Contr., 19:716-723.
  • Dayhoff, M.O., Schwartz, R.M., Orcutt, B.C. (1978); A model of evolutionary change in proteins. In: Dayhoff, M.O. (ed.) Atlas of Protein Sequence Structur., Vol~5, Suppl~3. National Biomedical Research Foundation, Washington DC, pp.~345- 352.
  • Disotell, T.R., Honeycutt, R.L., Ruvolo, M. (1992); Mitochondrial DNA phylogeny of the Old-World monkey tribe Papionini. Mol. Biol. Evol., 9:1-13.
  • Doebley, J., Durbin, M., Golenberg, E.M., Clegg, M.T., Ma D.-P. (1990); Evolutionary analysis of the large subunit of carboxylase ( rbc L) nucleotide sequence among the grasses (Gramineae). Evolutio., 44:1097-1108.
  • Edwards, S.V., Arctander, P., Wilson, A.C. (1991); Mitochondrial resolution of a deep branch in the genealogical tree for perching birds. Proc. Roy. Soc. Londo., B243:99-107.
  • Felsenstein. J. (1978a); The number of evolutionary trees. System. Zool., 27:27-33.
  • Felsenstein. J. (1978b); Cases in which parsimony and compatibility methods will be positively misleading. System. Zool., 27:401-410
  • Felsenstein, J. (1981); Evolutionary trees from DNA sequences: a maximum likelihood approach. J. Mol. Evol., 17:368-376
  • Felsenstein, J. (1985); Confidence limits on phylogenies: an approach using the bootstrap. Evolutio., 39:783-791.
  • Felsenstein, J. (1992); Phylogenies from restriction sites: a maximum-likelihood approach. Evolutio., 46:159-173.
  • Golenberg, E.M., Giannasi, D.E., Clegg, M.T., Smiley, C.J., Durbin, M., Henderson, D., Zurawski, G. (1990); Chlorolplast DNA sequence from a Miocene Magnolia species. Natur., 344:656-658.
  • Hasegawa, M., Yano, T. (1984a); Phylogeny and classification of Hominoidea as inferred from DNA sequence data. Proc. Japan Acad., B60:389-392.
  • Hasegawa, M., Yano, T. (1984b); Maximum likelihood method of phylogenetic inference from DNA sequence data. Bull. Biomet. Soc. Jp., 5:1-7.
  • Hasegawa, M., Iida, Y., Yano, T., Takaiwa, F., Iwabuchi, M. (1985); Phylogenetic relationships among eukaryotic kingdoms inferred from ribosomal RNA sequences. J. Mol. Evol., 22:32-38.
  • Hasegawa, M., Kishino, H. (1989); Confidence limits on the maximum-likelihood estimate of the hominoid tree from mitochondrial- DNA sequences. Evolutio., 43:672-677.
  • Hasegawa, M. (1990); Phylogeny and molecular evolution in primates. Jpn. J. Genet., 65:243-265.
  • Hasegawa, M. (1991); Molecular phylogeny and man's place in Hominoidea. J. Anthrop. Soc. Nippo., 99:49-61.
  • Hasegawa, M., Kishino, H., Hayasaka, K., Horai, S. (1990a); Mitochondrial DNA evolution in primates: Transition rate has been extremely low in lemur. J. Mol. Evol., 31:113-121.
  • Hasegawa, M., Iwabe, N., Mukohata, Y., Miyata, T. (1990b); Close evolutionary relatedness of archaebacteria, Methanococcus and Halobacteriu., to eukaryotes demonstrated by composite phylogenetic trees of elongation factors EF-Tu and EF-G: eocyte tree is unlikely. Jpn. J. Genet., 65:109-114.
  • Hasegawa, M., Kishino, H., Saitou, N. (1991); On the maximum likelihood method in molecular phylogenetics. J. Mol. Evol., 32:443-445.
  • Hasegawa, M., Cao, Y., Adachi, J., Yano, T. (1992); Rodent polyphyly? Natur., 355:595-595.
  • Hasegawa, M., Hashimoto, T., Adachi, J., Iwabe, N., Miyata, T. (1993); Early divergences in the evolution of eukaryotes: ancient divergence of Entamoeba that lacks mitochondria revealed by protein sequence data. J. Mol. Evol., (in press).
  • Hashimoto, T., Otaka, E., Adachi, J., Mizuta, K., Hasegawa, M. (1993); The giant panda is most close to a bear, judged by - and hemoglobin sequences. J Mol Evol. (in press).
  • IUPAC-IUB Commission on Biochemical Nomenclature (1968); A one-letter notation for amino acid sequences, tentative rules. J. Biol. Chem., 243:3557-3559.
  • Iwabe, N., Kuma, K., Hasegawa, M., Osawa, S., Miyata, T. (1989); Evolutionary relationship of archaebacteria, eubacteria, and eukaryotes inferred from phylogenetic trees of duplicated genes. Proc. Natl. Acad. Sci. US., 86:9355-9359.
  • Iwabe, N., Kuma, K., Kishino, H., Hasegawa, M., Miyata, T. (1991); Evolution of RNA polymerases and branching patterns of the three major groups of archaebacteria. J. Mol. Evol., 32:70-78.
  • Kishino, H., Hasegawa, M. (1989); Evaluation of the maximum likelihood estimate of the evolutionary tree topologies from DNA sequence data, and the branching order in Hominoidea. J. Mol. Evol., 29:170-179.
  • Kishino, H., Miyata, T., Hasegawa, M. (1990); Maximum likelihood inference of protein phylogeny and the origin of chloroplasts. J. Mol. Evol., 30:151-160.
  • Les, D.H., Garvin, D.K., Wimpee, C.F. (1991); Molecular evolutionary history of ancient aquatic angiosperms. Proc. Natl. Acad. Sci. US., 88:10119-10123.
  • Lockhart, P.J., Howe, C.J., Bryant, D.A., Beanland, T.J., Larkum, A.W.D. (1992); Substitutional bias confounds inference of cyanelle origins from sequence data. J. Mol. Evol., 34:153-162.
  • Loomis, W.F., Smith, D.W. (1990); Molecular phylogeny of Dictyostelium discoideum by protein sequence comparison. Proc. Natl. Acad. Sci. US., 87:9093-9097.
  • Miyata, T., Iwabe, N., Kuma, K., Kawanishi, Y., Hasegawa, M., Kishino, H., Mukohata, Y., Ihara, K., Osawa, S. (1991); Evolution of archaebacteria: Phylogenetic relationships among archaebacteria, eubacteria, and eukaryotes. In: Osawa, S., Honjo, T. (eds.) Evolution of Life: Fossils, Molecules, and Culture . Springer-Verlag, Tokyo, pp. 337-351.
  • Mukohata, Y., Ihara, K., Kishino, H., Hasegawa, M., Iwabe, N., Miyata, T. (1990); Close evolutionary relatedness of archaebacteria with eukaryotes. Proc. Japan Acad., B66:63-67.
  • Saitou, N, Nei, M. (1987); The neighbor-joining method: a new method for reconstructing phylogenetic trees. Mol. Biol. Evol., 4:406-425.
  • Ruvolo, M., Disotell, T.R., Allard, M.W., Brown, W.M., Honeycutt, R.L. (1991); Resolution of the African hominoid trichotomy by use of a mitochondrial gene sequence. Proc. Natl. Acad. Sci. US., 88:1570-1574.
  • Sogin, M.L., Edman, U., Elwood, H. (1989); A single kingdom of eukaryotes. In: Fernholm, B., Bremer, K., J rnvall, H. (eds.) The Hierarchy of Life . Elsevier Science Publisher, Amsterdam, pp. 133-143.
  • Woese, C.R. (1989); Bacterial evolution. Microbiol. Rev., 51:221-271.
  • Zillig, W., Klenk, H.-P., Palm, P., Leffers, H., P hler, G., Gropp, F., Garrett, R.A. (1989); Did eukaryotes originate by a fusion event? Endocytobiosis Cell Res., 6:1-25